• Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder
  • Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder
  • Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder
  • Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder
  • Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder
  • Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder

Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder

Powder: Yes
Customized: Customized
Certification: GMP, HSE, ISO 9001, USP, BP
Suitable for: Elderly, Children, Adult
State: Solid
Purity: 95%
Customization:
Diamond Member Since 2019

Suppliers with verified business licenses

Rating: 5.0/5
Manufacturer/Factory

Basic Info.

Model NO.
top quality
CAS No.
N/a
Sequence
N/a
Mf
N/a
Appearance
White Powder
MOQ
10mg
Storge
2-8 Degree
Exp.
24 Months
Transport Package
Per Bottle
Specification
10mg
Trademark
senwayer
Origin
China
HS Code
2601111000
Production Capacity
500g Per Month

Product Description

anti aging FOXO4 D-Retro-Inverso peptide 95% FOXO4-DRI 98% Senolytics powder

EGF, FGF, KGF, SOD, FOXO4-dri and all cosmetic powder

raw powder, freeze-dired fine powder all available


Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder


Physical Characters and specifications

Name FOXO4 DRI
CAS N/A
Grade Standard Injection grade
COA Pls contact with Senwayer freely
MOQ 10mg
Appearance White powder
Purity, % (by RP-HPLC) 95%
Activity unit N/A
pH value N/A
Isoelectric point N/A
Water residue N/A
Identification test N/A
Storage 2 - 8 degree
EXP time 2 years
 

Product description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice

 
related products
No. Product Name CAS No.
 Anti-wrinkle & Anti-aging Series  
1 Acetyl Hexapeptide-8 616204-22-9
2  Acetyl Octapeptide-3/Snap-8 868844-74-0
3 Palmitoyl Tripeptide-5  /Collagen Peptide 623172-56-5
4 Palmitoyl Pentapeptide-4 /Matrixyl Acetate 214047-00-4
5  Pentapeptide-18 /Leuphasyl 64963-01-5
6 Hexapeptide-10/Serilesine 146439-94-3
7 Palmitoyl Hexapeptide / Lipopeptide Acetate 171263-26-6
8  Palmitoyl Tripeptide-1 147732-56-7
9 Pentapeptide-3/Vialox Peptide   135679-88-8
10 Acetyl Tetrapeptide-2 757942-88-4
11 Acetyl Tetrapeptide-9 928006-50-2
12 L-Carnosine 305-84-0
13 Decorinyl/Tripeptide-10 Citrulline 960531-53-7
14 Palmitoyl Tripeptide-38 1447824-23-8
15 Acetyl Decapeptide-3 935288-50-9
16 Hexapeptide-11 --------
Whitening & Freckle Removing Series  
1 Nonapeptide-1/Melitane 158563-45-2
2 Tetrapeptide-30  ---------
3 Decapeptide-12  ---------
4 Hexapeptide-2  ---------
5 Melanostatin DM 123689-72-5
6 Oligopeptide-68 1206525-47-4
 Eye Care and Hair Growth Series  
1 Acetyl Tetrapeptide-5 820959-17-9
2 Myristoyl Pentapeptide-17 959610-30-1
3 Myristoyl Tetrapeptide-12 959610-24-3
4 Acetyl Tetrapeptide-3/Capixyl 155149-79-4
5 Biotinoyl Tripeptide-1 299157-54-3
6 Melitane/Acetyl Hexapeptide-1 448944-47-6
7 Myristoyl Pentapeptide-4   ---------
Anti-allergic & Skin Repair Series  
1 Pal-Tetrapeptide-7 /Pal-Tetrapeptide-3 221227-05-0
2 Copper Peptide 49557-75-7
3 Hexapeptide-9 1228371-11-6
4 Palmitoyl Tripeptide-8 936544-53-5
5 Oligopeptide-10  ---------
6 LZ1 Peptide  ---------
Breast Series  
1 Acetyl Hexapeptide-38 1400634-44-7
Weight Loss series  
1 Acetyl Hexapeptide-39  ---------

Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder
Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder
Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder

Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder

Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder
Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics PowderAnti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder
Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder
Anti Aging Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder
 

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now