Longevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw Powder

Product Details
Customization: Available
Appearance: Powder
Quality: Refined
Diamond Member Since 2025

Suppliers with verified business licenses

Audited Supplier Audited Supplier

Audited by an independent third-party inspection agency

to see all verified strength labels (11)
  • Longevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw Powder
  • Longevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw Powder
  • Longevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw Powder
  • Longevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw Powder
  • Longevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw Powder
  • Longevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw Powder
Find Similar Products
  • Overview
  • Related Products
  • Customized Service
Overview

Basic Info.

Model NO.
Foxo4-DRI
Colour
White
Types
Lyophilized Powder
Storage
2-8 Degree
COA
Please Contact Senwayer Freely
Grade Standard
Medcine Grade
Transport Package
Foil Bag or 10 Vials Per Box
Specification
10mg/vial, 10 vials per box
Trademark
Senwayer
Origin
China
Production Capacity
5000 Box/Month

Product Description

We can provide lyophilized powder or raw powder for you, and the above is the price of lyophilized powder. If you have interestes in raw powder, you can contact me  for the price of the raw powder.
 

Longevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw Powder

Physical Characters and specifications

Supply FOXO4-DRI raw powder and freeze powder in vials.

Name FOXO4 DRI
CAS N/A
Grade Standard Injection grade
COA Pls contact with Senwayer freely
MOQ 10mg
Appearance White powder
Purity, % (by RP-HPLC) 95%
Activity unit N/A
pH value N/A
Isoelectric point N/A
Water residue N/A
Identification test N/A
Storage 2 - 8 degree
EXP time 2 years
 

Product description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice

Contact for more product and  We also supply 
Related products:
 
No. Product Name CAS No.
 Anti-wrinkle & Anti-aging Series  
1 Acetyl Hexapeptide-8 616204-22-9
2  Acetyl Octapeptide-3/Snap-8 868844-74-0
3 Palmitoyl Tripeptide-5  /Collagen Peptide 623172-56-5
4 Palmitoyl Pentapeptide-4 /Matrixyl Acetate 214047-00-4
5  Pentapeptide-18  64963-01-5
6 Hexapeptide-10/Serilesine 146439-94-3
7 Palmitoyl Hexapeptide / Lipopeptide Acetate 171263-26-6
8  Palmitoyl Tripeptide-1 147732-56-7
9 Pentapeptide-3/Vialox Peptide   135679-88-8
10 Acetyl Tetrapeptide-2 757942-88-4
11 Acetyl Tetrapeptide-9 928006-50-2
12 L-Carnosine 305-84-0
13 Decorinyl/Tripeptide-10 Citrulline 960531-53-7
14 Palmitoyl Tripeptide-38 1447824-23-8
15 Acetyl Decapeptide-3 935288-50-9
16 Hexapeptide-11 --------
Whitening & Freckle Removing Series  
1 Nonapeptide-1/Melitane 158563-45-2
2 Tetrapeptide-30  ---------
3 Decapeptide-12  ---------
4 Hexapeptide-2  ---------
5 Melanostatin DM 123689-72-5
6 Oligopeptide-68 1206525-47-4
 Eye Care and Hair Growth Series  
1 Acetyl Tetrapeptide-5 820959-17-9
2 Myristoyl Pentapeptide-17 959610-30-1
3 Myristoyl Tetrapeptide-12 959610-24-3
4 Acetyl Tetrapeptide-3/Capixyl 155149-79-4
5 Biotinoyl Tripeptide-1 299157-54-3
6 Melitane/Acetyl Hexapeptide-1 448944-47-6
7 Myristoyl Pentapeptide-4   ---------
Anti-allergic & Skin Repair Series  
1 Pal-Tetrapeptide-7 /Pal-Tetrapeptide-3 221227-05-0
2 Copper Peptide 49557-75-7
3 Hexapeptide-9 1228371-11-6
4 Palmitoyl Tripeptide-8 936544-53-5
5 Oligopeptide-10  ---------
6 LZ1 Peptide  ---------
Breast Series  
1 Acetyl Hexapeptide-38 1400634-44-7
series  
1 Acetyl Hexapeptide-39  ---------
 

Related Products

Name CAS No. Name  CAS No. 
Thymalfasin 69440-99-9 Enfuvirtide (T-20) Acetate 159519-65-0
Thymopentin Acetate (TP-5) 69558-55-0 Angiotensin Acetate 58-49-1
Octreotide Acetate 83150-76-9 Somatostatin 51110-01-1
Melanotan II Acetate 121062-08-6 Vapreotide Acetate 103222-11-3
Melanotan I Acetate 75921-69-6 Dy norphin A (1-13) 72957-38-1
Secretin Acetate 17034-35-4   53714-56-0
Ornipressin Acetate 3397-23-7 Eledoisin Acetate 69-25-0
Oxytocin Acetate 50-56-6 GLP-1 (7-37) Acetate 106612-94-6
Lypressin Acetate 50-57-7 Pramlintide Pramlintide
Nesiritide Acetate 114471-18-0 Aviptadil Acetate 40077-57-4
Calcitonin (Salmone) Acetate 47931-85-1 Exenatide Acetate 141732-76-5

Customized Service

 

FAQ

Q1:Can i get free sample ?
A: Yes, most product we can send you small free sample, you just need to pay the shipping cost .
 

Q2:Which payment method you accept?
A: We accept bank transfer,western union, money gram,bitcoin, USDT,Credit card etc. and more bigger order we accept L/C at sight
 

Q3: Can i get tracking number after shipment ? and how long does the shipping take?
A: After shipment we will offer you tracking and tell you the website to track the package, usually the shipping time is 3-7days,but for some customers have no ability to declare customs, we use special line route to ship the package, it will take 10-12days to arrive,make sure 100% delivery
 

Q4: How can you guarantee the quality ?
A: All products we can supply you test report &you can also send our product to the third party to do test, if it is fake,we will full refund you.
Longevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw PowderLongevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw PowderLongevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw PowderLongevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw PowderLongevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw PowderLongevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw PowderLongevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw PowderLongevity Peptide High Purity Foxo4-Dri Purity 98% Foxo4 D-Retro-Inverso Raw Powder

 

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now
Contact Supplier